General Information

  • ID:  hor003125
  • Uniprot ID:  Q9VET0
  • Protein name:  Neuropeptide F
  • Gene name:  NPF
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  Expression is high in larvae seeking food and is down-regulated in late embryos coinciding with the onset of the behavior of older larvae, including food aversion, hypermobility, and cooperative burrowing. In males, expression is increased by mating and r
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0071859 neuropeptide F receptor binding
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007586 digestion; GO:0007610 behavior; GO:0007623 circadian rhythm; GO:0008049 male courtship behavior; GO:0008345 larval locomotory behavior; GO:0030536 larval feeding behavior; GO:0032095 regulation of response to food; GO:0035176 social behavior; GO:0035177 larval foraging behavior; GO:0042048 olfactory behavior; GO:0044703 multi-organism reproductive process; GO:0045475 locomotor rhythm; GO:0048512 circadian behavior; GO:1990834 response to odorant
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NDVNTMADAYKFLQDLDTYYGDRARVRF
  • Length:  28(35-62)
  • Propeptide:  MCQTMRCILVACVALALLAAGCRVEASNSRPPRKNDVNTMADAYKFLQDLDTYYGDRARVRFGKRGSLMDILRNHEMDNINLGKNANNGGEFARGFNEEEIF
  • Signal peptide:  MCQTMRCILVACVALALLAAGCRVEA
  • Modification:  T28 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Integral part of the sensory system that mediates food signaling, providing the neural basis for the regulation of food response; coordinates larval foraging and social behavior changes during development. Required in dopaminergic (DA) neurons that innerv
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPFR
  • Target Unid:   Q9VNM1
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8LD63-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q8LD63-F1.pdbhor003125_AF2.pdbhor003125_ESM.pdb

Physical Information

Mass: 384048 Formula: C148H221N41O47S
Absent amino acids: CEHIPSW Common amino acids: D
pI: 4.56 Basic residues: 4
Polar residues: 8 Hydrophobic residues: 9
Hydrophobicity: -79.29 Boman Index: -8569
Half-Life / Aliphatic Index: 1.4 hour Aliphatic Index: 59.29
Instability Index: 1982.14 Extinction Coefficient cystines: 4470
Absorbance 280nm: 165.56

Literature

  • PubMed ID:  10499420
  • Title:  Identification of a Drosophila Brain-Gut Peptide Related to the Neuropeptide Y Family.
  • PubMed ID:  11257610
  • Title:  Drosophila neuropeptide F mediates integration of chemosensory stimulation and conditioning of the nervous system by food.
  • PubMed ID:  12848939
  • Title:  Developmental control of foraging and socia
  • PubMed ID:  15677721
  • Title:  
  • PubMed ID:  19837040
  • Title:  
  • PubMed ID:  20164335
  • Title:  
  • PubMed ID:  22422983
  • Title: